PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID ORUFI01G34710.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family Dof
Protein Properties Length: 204aa    MW: 22291.9 Da    PI: 9.6194
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
ORUFI01G34710.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.75.3e-38100155459
           zf-Dof   4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknk 59 
                      + l+cprC s++tkfCy+nny+++qPr+fCkaC+ryWt+GGalrnvPvG+grrkn+
  ORUFI01G34710.1 100 APLPCPRCRSRDTKFCYFNNYNVNQPRHFCKACHRYWTAGGALRNVPVGAGRRKNR 155
                      5689**************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074783.0E-26102155IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.751102156IPR003851Zinc finger, Dof-type
PfamPF027014.1E-31102155IPR003851Zinc finger, Dof-type
PROSITE patternPS013610104140IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MAPAAGGFKL FGKVIMQCGV SEGTQDKAQG FVVAREKVEP EEEEEEQRVP AAATSGQRAS  60
IKREAADRDE EQRQGGGDAA GQPTQRRLQD SAEARAAAAA PLPCPRCRSR DTKFCYFNNY  120
NVNQPRHFCK ACHRYWTAGG ALRNVPVGAG RRKNRPLGPL AVAHHHHHHR AAAGFVLGFP  180
NPSSPTSPSP VYTDRWPVTP DRPF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126090.0CP012609.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015630447.11e-110PREDICTED: cyclic dof factor 2
SwissprotQ8W1E35e-35CDF1_ARATH; Cyclic dof factor 1
TrEMBLA0A0E0N2P21e-150A0A0E0N2P2_ORYRU; Uncharacterized protein
TrEMBLA2WV871e-150A2WV87_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA000793-PA1e-150(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP64952851
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G34140.13e-33Dof family protein